PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_136.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 389aa    MW: 42454.9 Da    PI: 8.853
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_136.16genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY94.76.7e-30107164260
                                   --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                          WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                                   +DgynWrKYGqK v+g+ef rsYY+Ct+++C vkk++ers+ d+++++++Y g+H+h+k
  evm.model.supercontig_136.16 107 EDGYNWRKYGQKLVRGNEFIRSYYKCTHPKCLVKKQLERSH-DGRITDTVYFGQHDHPK 164
                                   7****************************************.***************85 PP

2WRKY102.42.6e-32279337159
                                   ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                          WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                   ++Dgy+WrKYGqK vkg+++prsYYrC+s+gC+vkk+ver+++dpk++++tYeg+H+h+
  evm.model.supercontig_136.16 279 VNDGYRWRKYGQKLVKGNPHPRSYYRCSSPGCRVKKHVERTSHDPKLLTTTYEGHHDHD 337
                                   58********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.7E-25103165IPR003657WRKY domain
SuperFamilySSF1182901.07E-23104165IPR003657WRKY domain
SMARTSM007743.0E-33106164IPR003657WRKY domain
PfamPF031061.0E-22107163IPR003657WRKY domain
PROSITE profilePS5081122.641107165IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.0E-35265339IPR003657WRKY domain
SuperFamilySSF1182904.84E-29271339IPR003657WRKY domain
PROSITE profilePS5081134.612274339IPR003657WRKY domain
SMARTSM007743.2E-37279338IPR003657WRKY domain
PfamPF031067.0E-26280336IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MASSGQAATD EATSDKLPDG VSSVGGTREL QPISGSISVS ENHQEGNIPS ITPEKASVEP  60
DQGAVHSEGH VPPSKSKKEP KTPDRTAHAV QSDTEGISPV IREKGSEDGY NWRKYGQKLV  120
RGNEFIRSYY KCTHPKCLVK KQLERSHDGR ITDTVYFGQH DHPKPNSTPV AVGFVVSIIE  180
ERQNIASSVA KEKSSDAHGD TPHQTGPVGN LQVPAVASKD DVKDVLLGSN RVGDEPDTSD  240
DPGLKRRKKD NYNMEIISVE KQSSEPRIVV QTRSEVDIVN DGYRWRKYGQ KLVKGNPHPR  300
SYYRCSSPGC RVKKHVERTS HDPKLLTTTY EGHHDHDKPP ARTVTHNTAG SDVHKIPSNK  360
ESGSSVESGN KSKDSGTGCR ITPPSRKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A8e-37108341276WRKY transcription factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00094SELEXTransfer from AT2G04880Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007049282.11e-128Zinc-dependent activator protein-1, putative isoform 1
RefseqXP_007049283.11e-128Zinc-dependent activator protein-1, putative isoform 1
RefseqXP_007049284.11e-128Zinc-dependent activator protein-1, putative isoform 1
SwissprotQ9SI372e-97WRKY1_ARATH; WRKY transcription factor 1
TrEMBLA0A061DMX71e-128A0A061DMX7_THECC; Zinc-dependent activator protein-1, putative isoform 1
STRINGVIT_12s0057g00550.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79492639
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.21e-100zinc-dependent activator protein-1